The domain within your query sequence starts at position 155 and ends at position 244; the E-value for the LINES_N domain shown below is 1.1e-26.

ILTAVIKEILKDTHSQRAESLKQLLTPFDITFEVFYNSLFSQHFGDFQSPSNLASSLMCF
LELLELLVASRIHLKLHFRSQRMLFLKPHA

LINES_N

LINES_N
PFAM accession number:PF14694
Interpro abstract (IPR032794):

This entry represents the N terminus of protein lines [(PUBMED:12119551)]. In Drosophila this protein is involved in embryonic segmentation and may function as a transcriptional regulator [(PUBMED:8241770), (PUBMED:11846473)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry LINES_N