The domain within your query sequence starts at position 273 and ends at position 385; the E-value for the LLGL domain shown below is 1.6e-46.

PVQTITPHGKQLKDGKKPEPCKPILKVELKTTRSGEPFIILSGGLSYDTVGRRPCLTVMH
GKSTAVLEMDYSIVDFLTLCETPYPNDFQEPYAVVVLLEKDLVLIDLAQNGYP

LLGL

LLGL
PFAM accession number:PF08366
Interpro abstract (IPR013577):

This domain is found in lethal giant larvae homologue 2 (LLGL2) proteins and syntaxin-binding proteins like tomosyn [(PUBMED:14767561)]. It has been identified in eukaryotes and tends to be found together with WD repeats (IPR001680).

This is a PFAM domain. For full annotation and more information, please see the PFAM entry LLGL