The domain within your query sequence starts at position 12 and ends at position 289; the E-value for the LMBR1 domain shown below is 2.7e-19.

WCIFGLLLLAILAFCWVYVRKYQSQRESEVVSTVTAIFSLAVALITSALLPVDIFLVSYM
KNQNGTFKDWADANVTVQIENTVLYGYYTLYSVILFCVFFWIPFVYFYYEEKDEDDASKC
TQIKTALKYTLGFVVICALLLLVGAFVPLHLPNNNNSTEWEKVKLLFEDLGTGQGLAALS
FSISSLTLIGMLAAITYTAYGMSALPLNLIKGTRSTAYERLENTEDIEEVEQHIQTIRSK
SKDGRPLPARDRRALKQCEERLRTLRKRERHLEFIENS

LMBR1

LMBR1
PFAM accession number:PF04791
Interpro abstract (IPR006876):

This group of uncharacterised proteins have a conserved C-terminal region which is found in LMBR1 and in the lipocalin-1 receptor. LMBR1 was thought to play a role in preaxial polydactyly, but recent evidence now suggests this not to be the case [(PUBMED:12032320)]. Vertebrate members of this family may play a role in limb development [(PUBMED:11090342)]. A member of this family has been shown to be a lipocalin membrane receptor [(PUBMED:11287427)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry LMBR1