The domain within your query sequence starts at position 122 and ends at position 589; the E-value for the LMF1 domain shown below is 5.6e-164.

LYFQWDSLLLETGFLAILVAPLRGPSKHKILQGRLAGALPHEDLPFWLVRWLLFRLMFAS
GVVKLTSRCPTWWGLTALTYHYETQCLPTPAAWFAHHLPVWLHKLSVVATFLIEIAVPPL
FFAPIRRLRLTAFYAQALLQVLIIITGNYNFFNLLTLVLTTALLDDRHLSAEPGLRCHKK
MPTSWPKALLTALSLLLELTVYGLLAYGTVYYFGLEVDWQQHIILSKTTFTFHQFSQWLK
TVTLPTVWLGTASLAWELLVVLWRWIQVQGWSRKFSAGIQLSVLGTATVALFLISLVPYS
YVEPGTHGRLWTGAHRLFGSVEHLQLANSYGLFRRMTGVGGRPEVVLEGSYDGQHWTEIE
FMYKPGNVSRPPPFLTPHQPRLDWQMWFAALGPHTHSPWFTGLVLRLLQGKEPVIRLVQS
HVANYPFHERPPTYLRAQRYKYWFSKPGDQSRWWHRQWVEEFFPSVSL

LMF1

LMF1
PFAM accession number:PF06762
Interpro abstract (IPR009613):

This family of transmembrane proteins includes the lipase maturation factors LMF1 and LMF2. Lipoprotein lipase and hepatic lipase require LMF1 to fold into their active states [(PUBMED:17994020), (PUBMED:19783858)]. The precise role of LMF1 in lipase folding has yet to be determined [(PUBMED:20543905)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry LMF1