The domain within your query sequence starts at position 114 and ends at position 163; the E-value for the LRAT domain shown below is 3.6e-9.

NKCSPGDLVEFVSQAQYPHWAVYVGNFQVVHLHRLEVSNSFLTDASQGRR

LRAT

LRAT
PFAM accession number:PF04970
Interpro abstract (IPR007053): This functionally uncharacterised domain is found in a variety of proteins, including lecithin retinol acyltransferase (LRAT), HRAS-like suppressor and Protein FAM84A.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry LRAT