The domain within your query sequence starts at position 22 and ends at position 347; the E-value for the LRIF1 domain shown below is 6.2e-145.

ISGCMYQVVPTIGSDGKKLLQLLPISKSSGNLIPVVQSPVMSHGLKANTEKPVQVTFQTQ
ISSSSTSASVQLPVFQPANTTKCFFTGAIDTTGKDRVTSVRTGNFTPPVSNIQNHGVKIH
KLTRQTFTIPPSTQNDSSHFIFNTPSLLPNVNSSILPSGNHLKIPAHAEVKSVLASSLPP
LVQQKILGTATTSTSGTVEASQIPTVVYVHPVNSVKFVVTKKTQTIYPKPVTFNTLQIPP
NVATETQLKGGQHPQAAPVNSIFQEYLQPGIPCIIPVKSSNNVATKVLNTFVGRKNLGDN
TIDTPLLNTNSSGRTHSCVFRDQESQ

LRIF1

LRIF1
PFAM accession number:PF15741
Interpro abstract (IPR026191): Ligand-dependent nuclear receptor-interacting factor 1 (LRIF1) was initially identified as a protein that interacts with retinoic acid receptors and other nuclear receptors [(PUBMED:17455211)]. The protein has been shown to repress the ligand-induced transcriptional activity of retinoic acid receptor alpha. Its repression activity is mediated at least in part through direct recruitment of histone deacetylases [(PUBMED:17455211)].
GO process:regulation of transcription, DNA-templated (GO:0006355)
GO function:retinoic acid receptor binding (GO:0042974)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry LRIF1