The domain within your query sequence starts at position 861 and ends at position 914; the E-value for the LRRC37 domain shown below is 2.8e-9.

VSQQIIIVHPPKHPLVIYSEQVHTQHPNPTEATAQPLNLELILTSQPTAEGELP

LRRC37

LRRC37
PFAM accession number:PF15779
Interpro abstract (IPR032754):

This domain is found in vertebrates, and is approximately 70 amino acids in length. The function of this domain is unknown.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry LRRC37