The domain within your query sequence starts at position 3063 and ends at position 3209; the E-value for the LRRC37AB_C domain shown below is 1.1e-77.

SPGEQFESHLNQQLLPLIPNKDVRRLISHVIRTLKMDCSDTRVQMSCAKLISRTGLLMKL
LSEQQDFKLSRADWDTDQWKTENYINESTETQGEQRSLEPSQLTKAVPGYGYNNKVILAI
SVTVIVTVLIIIFCLIEIYSHRTAKEG

LRRC37AB_C

LRRC37AB_C
PFAM accession number:PF14914
Interpro abstract (IPR029423):

This entry represents the C-terminal domain of the putative Leucine Rich Repeat Containing protein 37A or protein 37B (LRRC37A/B) found in eukaryotes. The Leucine Rich Repeats (LRR) lies in the central region. The gene that encodes this protein is found in the chromosomal position 17q11.2, and its microdeletion results in the disease, neurofibromatosis type-1 (NF1) [(PUBMED:20506354)]. The function of the protein, LRRC37B is unknown, however experimental data shows expression in the aorta, heart, skeletal muscle, liver and brain during gestation [(PUBMED:16138909)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry LRRC37AB_C