The domain within your query sequence starts at position 134 and ends at position 249; the E-value for the LRR_5 domain shown below is 9e-7.

HLPAFHKIQSLQKVLLDIQDNINIHIIARNSFMGLSFESVILWLNKNGIQEIHNCAFNGT
QLDELNLSDNNNLEELPDDVFQGASGPVVLDISRTKVYSLPNHGLENLKKLRARST

LRR_5

LRR_5
PFAM accession number:PF13306
Interpro abstract (IPR026906): This entry represents a leucine rich repeat. A leucine-rich repeat (LRR) is a protein structural motif that forms an alpha/beta horseshoe fold [(PUBMED:7817399), (PUBMED:14747988)]. Leucine-rich repeats are frequently involved in the formation of protein protein interactions [(PUBMED:11751054), (PUBMED:1657640)].

This repeat is found in a large number of BSPA-like surface antigens from Trichomonas vaginalis.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry LRR_5