The domain within your query sequence starts at position 137 and ends at position 228; the E-value for the LRR_5 domain shown below is 3.8e-5.
GLRIFPDLTKIYSTDIFFILEITDNPYMTSVPENAFQGLCNETLTLKLYNNGFTSVQGHA FNGTKLDAVYLNKNKYLTAIDNDAFGGVYSGP
LRR_5 |
---|
PFAM accession number: | PF13306 |
---|---|
Interpro abstract (IPR026906): | This repeat is found in a large number of BSPA-like surface antigens from Trichomonas vaginalis. This entry represents a leucine rich repeat. A leucine-rich repeat (LRR) is a protein structural motif that forms an alpha/beta horseshoe fold [ (PUBMED:7817399) (PUBMED:14747988) ]. Leucine-rich repeats are frequently involved in the formation of protein protein interactions [ (PUBMED:11751054) (PUBMED:1657640) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry LRR_5