The domain within your query sequence starts at position 1 and ends at position 56; the E-value for the LSM14 domain shown below is 3e-11.

MAMDWLGSIVSINCGDSLGVYQGRVSAVDQVSQTISLTRPFHNGVKCLVPEVTFRV

LSM14

LSM14
PFAM accession number:PF12701
Interpro abstract (IPR025609):

The Lsm14 N-terminal domain is a type of LSM domain found in Lsm14 proteins (also known as Rap55) [(PUBMED:17074753), (PUBMED:18723115)] and in the Saccharomyces cerevisiae homologue Scd6 [(PUBMED:15225602)]. The domain is also found in the human EDC3 protein (enhancer of mRNA-decapping protein 3) where it is fused to the the Rossmanoid YjeF-N domain [(PUBMED:15257761)]. In addition, both EDC3 and Scd6 are found fused to the FDF domain [(PUBMED:15225602), (PUBMED:15257761)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry LSM14