The domain within your query sequence starts at position 187 and ends at position 235; the E-value for the LSR domain shown below is 2.3e-25.

DWLFVVVVCLASLLFFLLLGICWCQCCPHTCCCYVRCPCCPDKCCCPEA

LSR

• PFAM accession number: PF05624
• Interpro abstract (IPR008664):

  This domain consists of mammalian LISCH7 protein homologues. LISCH7 is a liver-specific BHLH-ZIP transcription factor.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry LSR