The domain within your query sequence starts at position 22 and ends at position 93; the E-value for the LST1 domain shown below is 5e-47.

LGGLLLLLVIILFICLCRFSQRVKRLERNAQVSGQEPHYASLQQLPVSSSDITDMKEDLS
TDYACIARSTPT

LST1

LST1
PFAM accession number:PF05083
Interpro abstract (IPR007775):

B144/LST1 is a gene encoded in the human major histocompatibility complex that produces multiple forms of alternatively spliced mRNA and encodes peptides fewer than 100 amino acids in length. B144/LST1 is strongly expressed in dendritic cells. Transfection of B144/LST1 into a variety of cells induces morphologic changes including the production of long, thin filopodia [ (PUBMED:11478849) ].

A possible role in modulating immune responses. Induces morphological changes including production of filopodia and microspikes when overexpressed in a variety of cell types and may be involved in dendritic cell maturation. Isoform 1 and isoform 2 have an inhibitory effect on lymphocyte proliferation [ (PUBMED:10706707) (PUBMED:11478849) ].

GO process:cell morphogenesis (GO:0000902), immune response (GO:0006955)
GO component:membrane (GO:0016020)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry LST1