The domain within your query sequence starts at position 1 and ends at position 302; the E-value for the LUC7 domain shown below is 4.2e-72.

MISAAQLLDELMGRDRNLAPDEKRSNVRWDHESVCKYYLCGFCPAELFTNTRSDLGPCEK
IHDENLRKQYEKSSRFMKVGYERDFLRYLQSLLAEVERRIRRGHARLALSQNQQSSGAAG
PTGKNEEKIQVLTDKIDVLLQQIEELGSEGKVEEAQGMMKLVEQLKEERELLRSTTSTIE
SFAAQEKQMEVCEVCGAFLIVGDAQSRVDDHLMGKQHMGYAKIKATVEELKEKLRKRTEE
PDRDERLKKEKQEREEREKEREREREERERKRRREEEEREKERARDRERRKRSRSRSRHS
SR

LUC7

LUC7
PFAM accession number:PF03194
Interpro abstract (IPR004882):

This family consists of several Luc7 protein homologues that are restricted to eukaryotes. In budding yeast, Luc7 is an essential subunit of the yeast U1 snRNP, which forms the spliceosomal commitment complex with other proteins that targets pre-mRNA to the splicing pathway [(PUBMED:17726058), (PUBMED:11170747)]. Its N-terminal zinc finger has been found to bind pre-mRNA [(PUBMED:17726058)]. This entry also contains human and mouse Luc7 like (LUC7L) proteins [(PUBMED:10500099)].

GO process:mRNA splice site selection (GO:0006376)
GO component:U1 snRNP (GO:0005685)
GO function:mRNA binding (GO:0003729)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry LUC7