The domain within your query sequence starts at position 70 and ends at position 186; the E-value for the LURAP domain shown below is 3.3e-56.

PASGSPRRSHPSALERLETKLHILRQEMVNLRATDVRLMRQLLLINESIESIKWMIEEKA
TITSRGSSLSGSLCSLLESQSTSLRGSYNSLHDGSDGLDGISVGSYLDTLADDVPGH

LURAP

LURAP
PFAM accession number:

This is a PFAM domain. For full annotation and more information, please see the PFAM entry LURAP