The domain within your query sequence starts at position 250 and ends at position 297; the E-value for the LYRIC domain shown below is 4.4e-13.
RSIFSGIDGLSSADPSSDWNAPAEEWGNWVDEDRASLLKSQEPISNDQ
LYRIC |
---|
PFAM accession number: | PF15686 |
---|---|
Interpro abstract (IPR031402): | LYRIC (Lysine-rich CEACAM1 co-isolated protein), also known as Astrocyte-elevated gene-1 (AEG-1), is a type-1b membrane protein with a single transmembrane domain and localises to the endoplasmic reticulum and the nuclear envelope. It is also found in the nucleolus, suggesting functional relationships between these two cellular compartments [ (PUBMED:14980505) ]. It is found to be colocalised with tight junction proteins ZO-1 and occludin in polarised epithelial cells, suggesting that LYRIC is part of the tight junction complex [ (PUBMED:15383321) ]. LYRIC has been shown to promote angiogenesis [ (PUBMED:19940250) ] and tumour cell migration and invasion by activating the transcription factor NF-kappaB [ (PUBMED:16452207) (PUBMED:18440304) (PUBMED:17704808) ]. |
GO process: | positive regulation of I-kappaB kinase/NF-kappaB signaling (GO:0043123), negative regulation of apoptotic process (GO:0043066), positive regulation of angiogenesis (GO:0045766) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry LYRIC