The domain within your query sequence starts at position 53 and ends at position 112; the E-value for the Lactamase_B_4 domain shown below is 3.1e-17.

QVVAAGGRDAGAALYVFSEYNRYLFNCGEGVQRLMQEHKLKVARLDNIFLTRMHWSNVGG

Lactamase_B_4

Lactamase_B_4
PFAM accession number:PF13691
Interpro abstract (IPR027794):

This domain is found in the RNase Z enzymes, which are closely related structurally to the Lactamase B family members. tRNase Z (ribonuclease Z) is the endonuclease that is involved in tRNA 3'-end maturation through removal of the 3'-trailer sequences from tRNA precursors. The fission yeast Schizosaccharomyces pombe contains two candidate tRNase Zs encoded by two essential genes. The first, Trz1, is targeted to the nucleus and has an SV40 nuclear localisation signal at its N terminus, consisting of four consecutive arginine and lysine residues between residues 208 and 211 (KKRK) that is critical for the NLS function. The second, Trz2, is targeted to the mitochondria, with an N-terminal mitochondrial targeting signal within the first 38 residues [(PUBMED:21208191)].

GO process:tRNA processing (GO:0008033)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Lactamase_B_4