The domain within your query sequence starts at position 163 and ends at position 296; the E-value for the Lactonase domain shown below is 4.6e-8.
GSRIFVWDWQRHEIIQTLQMTDGLIPLEIRFLHDPSATQGFVGCALSSNIQRFYKNEEGT WSVEKVIQVPSKKVKGWMLPEMPGLITDILLSLDDRFLYFSNWLHGDIRQYDISNPQKPR LTGQIFLGGSIVRG
Lactonase |
---|
PFAM accession number: | PF10282 |
---|---|
Interpro abstract (IPR019405): | 6-phosphogluconolactonases (6PGL) EC 3.1.1.31 which hydrolyses 6-phosphogluconolactone to 6-phosphogluconate is one of the enzymes in the pentose phosphate pathway. Two families of structurally dissimilar 6PGLs are known to exist: the Escherichia coli (strain K12) YbhE IPR022528 [ (PUBMED:15576773) ] and the Pseudomonas aeruginosa DevB IPR005900 [ (PUBMED:10869070) ] types. This entry contains bacterial 6-phosphogluconolactonases (6PGL) YbhE-type EC 3.1.1.31 which hydrolyse 6-phosphogluconolactone to 6-phosphogluconate. The entry also contains the fungal muconate lactonizing enzyme carboxy-cis,cis-muconate cyclase EC 5.5.1.5 and muconate cycloisomerase EC 5.5.1.1 which convert cis,cis-muconates to muconolactones and vice versa as part of the microbial beta-ketoadipate pathway. Structures have been reported for the E. coli 6-phosphogluconolactonase and Neurospora crassa muconate cycloisomerase. Structures of proteins in this family have revealed a 7-bladed beta-propeller fold [ (PUBMED:11937053) ]. The surface antigen Lp49 from Leptospira interrogans, the causative agent of leptospirosis, contains a C-terminal beta propellor domain that is also included in this entry. The structure of the Lp49 protein has been solved, and because it is an antigen is a potential drug target [ (PUBMED:18508281) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Lactonase