The domain within your query sequence starts at position 27 and ends at position 173; the E-value for the Las1 domain shown below is 1e-45.

VVSWLSRAEWEQVTVYLFCDDHKLQQYALNRITVWRSRLGNELPLAVASTADLVRCKLID
AAGTLGTDELRLLYGMALVRFVNLISERKTKCSNLPLKYLAQEVNIPDWIVELRHNLTHK
KMPHINECRRGCYFVLNWLQKTYWSRQ

Las1

Las1
PFAM accession number:PF04031
Interpro abstract (IPR007174): Las1 is an essential nuclear protein involved in cell morphogenesis and cell surface growth [(PUBMED:8582632)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Las1