The domain within your query sequence starts at position 25 and ends at position 75; the E-value for the Lbh domain shown below is 5.9e-14.
VGVREKGPWLCQRLPSIVVEPTEAGAVESGELRWPPEGTQRGTPQIQAAAA
Lbh |
---|
PFAM accession number: | PF15317 |
---|---|
Interpro abstract (IPR038990): | LBH (limb-bud and heart) protein may act as a transcriptional activator in mitogen-activated protein kinase signalling pathway to mediate cellular functions. It has been shown to regulate cardiac gene expression by modulating the combinatorial activities of key cardiac transcription factors, as well as their individual functions in cardiogenesis in mice [ (PUBMED:17390236) ]. Proteins containing this domain include Protein LBH, and LBH domain-containing protein 1 (LBHD1) from humans. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Lbh