The domain within your query sequence starts at position 164 and ends at position 198; the E-value for the Ldh_1_C domain shown below is 1.7e-7.

CNLDSARFRYLMAEKLGIHPSSCHGWILGEHGDSS

Ldh_1_C

Ldh_1_C
PFAM accession number:PF02866
Interpro abstract (IPR022383):

L-lactate dehydrogenases are metabolic enzymes which catalyse the conversion of L-lactate to pyruvate, the last step in anaerobic glycolysis [(PUBMED:11276087)]. L-lactate dehydrogenase is also found as a lens crystallin in bird and crocodile eyes. L-2-hydroxyisocaproate dehydrogenases are also members of the family. Malate dehydrogenases catalyse the interconversion of malate to oxaloacetate [(PUBMED:8117664)]. The enzyme participates in the citric acid cycle.

This entry represents the C-terminal, and is thought to be an is an unusual alpha+beta fold.

GO process:oxidation-reduction process (GO:0055114)
GO function:oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor (GO:0016616)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Ldh_1_C