The domain within your query sequence starts at position 540 and ends at position 646; the E-value for the LepA_C domain shown below is 1.3e-48.
LNGNMVEELVTVVHREKAYTVGKSICERLKESLPRQLYEIAIQAAVGSKVIARETVKAYR KNVLAKCYGGDITRKMKLLKRQSEGKKKLRKIGNIEIPKDAFIKVLK
LepA_C |
---|
PFAM accession number: | PF06421 |
---|---|
Interpro abstract (IPR013842): | The elongation factor 4 (LepA or GUF1 in Saccaromyces) is a GTP-binding membrane protein related to EF-G and EF-Tu. LepA is a noncanonical GTPase that has an unknown function. It is highly conserved and present in bacteria, mitochondria, and chloroplasts [ (PUBMED:28320876) ]. LepA contains domains that are homologous to EF-G domain I, II, III, V. However, it also contains a C-terminal domain (CTD) that is not homologous to any region in EF-G. This entry represents the unique C-terminal region of LepA [ (PUBMED:18362332) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry LepA_C