The domain within your query sequence starts at position 28 and ends at position 120; the E-value for the Lep_receptor_Ig domain shown below is 6.4e-20.

CKLGTVTVQPAPVIPLGSAANISCSLNPKQGCSHYPSSNELILLKFVNDVLVENLHGKKV
HDHTGHSSTFQVTNLSLGMTLFVCKLNCSNSQK

Lep_receptor_Ig

Lep_receptor_Ig
PFAM accession number:PF06328
Interpro abstract (IPR010457):

This entry represents a ligand-binding domain that displays similarity to C2-set immunoglobulin domains (antibody constant domain 2) [(PUBMED:9501088)]. The two cysteine residues form a disulphide bridge.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Lep_receptor_Ig