The domain within your query sequence starts at position 731 and ends at position 988; the E-value for the Lgl_C domain shown below is 3e-9.
YNRSRSSSISSIDKDSKEAITALYFMESFARKNDSTVSPCLFVGTSLGMVVLISLNLPSS DEQRFTEPVVVLPSGTFLSLKGAVLTFSCMDRTGSLMQPPYEVWRDPNNTDENEKTWKRK LVMNYSSSSQEMGDHQYTIICSEKQAKVFSLPSQTCLYVHNITETSFILQADVVVMCNSA CLACFCANGHIMIMSLPSLRPMLDVNYLPLTDMRIARTFCFTNEGQALYLVSPTEIQRLT YSQEMCDNIQDMLGDLFT
Lgl_C |
---|
PFAM accession number: | PF08596 |
---|---|
Interpro abstract (IPR013905): | The Lethal giant larvae (Lgl) tumour suppressor protein is conserved from yeast to mammals. The Lgl protein functions in cell polarity, at least in part, by regulating SNARE-mediated membrane delivery events at the cell surface [ (PUBMED:15964280) ]. The N-terminal half of Lgl members contains WD40 repeats (see IPR001680 ), while the C-terminal half appears specific to the protein [ (PUBMED:15964280) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Lgl_C