The domain within your query sequence starts at position 731 and ends at position 988; the E-value for the Lgl_C domain shown below is 3e-9.

YNRSRSSSISSIDKDSKEAITALYFMESFARKNDSTVSPCLFVGTSLGMVVLISLNLPSS
DEQRFTEPVVVLPSGTFLSLKGAVLTFSCMDRTGSLMQPPYEVWRDPNNTDENEKTWKRK
LVMNYSSSSQEMGDHQYTIICSEKQAKVFSLPSQTCLYVHNITETSFILQADVVVMCNSA
CLACFCANGHIMIMSLPSLRPMLDVNYLPLTDMRIARTFCFTNEGQALYLVSPTEIQRLT
YSQEMCDNIQDMLGDLFT

Lgl_C

Lgl_C
PFAM accession number:PF08596
Interpro abstract (IPR013905):

The Lethal giant larvae (Lgl) tumour suppressor protein is conserved from yeast to mammals. The Lgl protein functions in cell polarity, at least in part, by regulating SNARE-mediated membrane delivery events at the cell surface [(PUBMED:15964280)]. The N-terminal half of Lgl members contains WD40 repeats (see IPR001680), while the C-terminal half appears specific to the protein [(PUBMED:15964280)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Lgl_C