The domain within your query sequence starts at position 804 and ends at position 976; the E-value for the Lgl_C domain shown below is 1.3e-8.

EPYEASRDLAQAPDMQGGHAVLIASEEQFKVFTLPKVSAKTKFKLTAHEGCRVRKVALAT
FASVMSEDYAETCLACLTNLGDVHVFSVPGLRPQVHYSCIRKEDISGIASCVFTRHGQGF
YLISPSEFERFSLSARNITEPLCSLDISWPQNATQPRLQESPKLSQANGTRDI

Lgl_C

Lgl_C
PFAM accession number:PF08596
Interpro abstract (IPR013905):

The Lethal giant larvae (Lgl) tumour suppressor protein is conserved from yeast to mammals. The Lgl protein functions in cell polarity, at least in part, by regulating SNARE-mediated membrane delivery events at the cell surface [ (PUBMED:15964280) ]. The N-terminal half of Lgl members contains WD40 repeats (see IPR001680 ), while the C-terminal half appears specific to the protein [ (PUBMED:15964280) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Lgl_C