The domain within your query sequence starts at position 1 and ends at position 368; the E-value for the Lig_chan domain shown below is 2.2e-20.

XALHLTALFLTLYEWRSPYGLTPRGRNRGTVFSYSSALNLCYAILFGRTVSSKTPKCPTG
RFLMNLWAIFCLLVLSSYTANLAAVMVGDKTFEELSGIHDPKLHHPSQGFRFGTVWESSA
EAYIKASFPEMHAHMRRHSAPTTPHGVAMLTSDPPKLNAFIMDKSLLDYEVSIDADCKLL
TVGKPFAIEGYGIGLPQNSPLTSNLSEFISRRCRWGSTTCQGCLSCCASGWAVHFSPRWV
STSSTAWCCRASAGAISCSIGFTRARRSTEPSTQGHQRGNRRGQSRSAAAPRRSNLQPTV
RGAGGGCAGPWWNGNGACVSCWNLGRLAGTIRGSAPMGPGCKQNCGSWSCALRLHGSGCV
VRCCGEGN

Lig_chan

 Lig_chan
PFAM accession number:PF00060
Interpro abstract (IPR001320):

There are three classes of ionotropic glutamate receptors (iGluRs), namely NMDA (N-methyl-D-aspartate), AMPA (alpha-amino-3-hydroxy-5-methyl-4-isoxazole-4-propionic acid) and kainate receptors. They are believed to play critical roles in synaptic plasticity. At many synapses in the brain, transient activation of NMDA receptors leads to a persistent modification in the strength of synaptic transmission mediated by AMPA receptors and kainate receptors can act as the induction trigger for long-term changes in synaptic transmission [ (PUBMED:10580501) ].

Ionotropic glutamate receptors (iGluRs) are a highly conserved family of ligand-gated ion channels present in animals, plants, and bacteria, which are best characterised for their roles in synaptic communication in vertebrate nervous systems [ (PUBMED:14977400) ]. A variant subfamily of iGluRs, the Ionotropic Receptors (IRs), consist of non-glutamate-binding chemosensory receptors first identified in Drosophila melanogaster. They function in detecting odors and tastants [ (PUBMED:20808886) ].

GO component:membrane (GO:0016020)
GO function:ligand-gated ion channel activity (GO:0015276)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Lig_chan