The domain within your query sequence starts at position 199 and ends at position 324; the E-value for the Ligase_CoA domain shown below is 9.3e-25.

VSRSGTLTYEAVHQTTQVGLGQSLCIGIGGDPFNGTDFIDCLEVFLNDPATEGIILIGEI
GGHAEENAAAFLKEHNSGPKAKPVVSFIAGITAPPGRRMGHAGAIIAGGKGGAKEKISAL
QSAGVV

Ligase_CoA

Ligase_CoA
PFAM accession number:PF00549
Interpro abstract (IPR005811):

This entry represents a domain found in both the alpha and beta chains of succinyl-CoA synthase (EC 6.2.1.4 (GDP-forming) and EC 6.2.1.5 (ADP-forming)) [(PUBMED:9917402), (PUBMED:10873456)]. This domain can also be found in ATP citrate synthase (EC 2.3.3.8) and malate-CoA ligase (EC 6.2.1.9). Some members of the domain utilise ATP others use GTP.

GO process:metabolic process (GO:0008152)
GO function:catalytic activity (GO:0003824)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Ligase_CoA