The domain within your query sequence starts at position 51 and ends at position 150; the E-value for the Lipase_3 domain shown below is 1.6e-4.
LLDGDATLPAIVFLHGLFGSKTNFNSLAKAMVQRTGRRVLTVDARNHGDSPHSPDASYEA MSQDLQGLLPQLGLVPCVLVGHSMGGKTAMLLALQRVSYT
Lipase_3 |
---|
PFAM accession number: | PF01764 |
---|---|
Interpro abstract (IPR002921): | This entry represents a domain with an alpha/beta hydrolase fold found in feruloyl esterase A [ (PUBMED:15081808) ]. It is similar to that found in fungal lipases [ (PUBMED:7656005) ]. |
GO process: | lipid metabolic process (GO:0006629) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Lipase_3