The domain within your query sequence starts at position 7 and ends at position 66; the E-value for the Lipase_3 domain shown below is 6.5e-5.

RRVLTVDARNHGDSPHSPDASYEAMSQDLQGLLPQLGLVPCVLVGHSMGGKTAMLLALQR

Lipase_3

Lipase_3
PFAM accession number:PF01764
Interpro abstract (IPR002921):

This entry represents a domain with an alpha/beta hydrolase fold found in feruloyl esterase A [ (PUBMED:15081808) ]. It is similar to that found in fungal lipases [ (PUBMED:7656005) ].

GO process:lipid metabolic process (GO:0006629)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Lipase_3