The domain within your query sequence starts at position 42 and ends at position 209; the E-value for the Lipase_GDSL domain shown below is 6.6e-9.

VLFVGDSMVQLMQQYEIWRELFSPLHALNFGIGGDTTRHVLWRLKNGELENIKPKVIVVW
VGTNNHENTAEEVAGGIEAIVQLINTRQPQAKIIVLGLLPRGEKPNPLRQKNAKVNQLLK
VSLPKLANVQLLDIDGGFVHSDGAISCHDMFDFLHLTGGGYAKICKPL

Lipase_GDSL

Lipase_GDSL
PFAM accession number:PF00657
Interpro abstract (IPR001087):

GDSL esterases and lipases are hydrolytic enzymes with multifunctional properties [ (PUBMED:15522763) ]. This new subclass of lipolytic enzymes possesses a distinct GDSL sequence motif different from the GxSxG motif found in many lipases [ (PUBMED:7610479) ]. Members include; Aeromonas hydrophila lipase, Vibrio mimicus arylesterase, Vibrio parahaemolyticus thermolabile haemolysin, rabbit phospholipase (AdRab-B), and Brassica napus anter-specific proline-rich protein.

GO function:hydrolase activity, acting on ester bonds (GO:0016788)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Lipase_GDSL