The domain within your query sequence starts at position 1 and ends at position 110; the E-value for the Lipin_N domain shown below is 1.1e-48.
MNYVGQLAGQVFVTVKELYKGLNPATLSGCIDIIVIRQPNGSLQCSPFHVRFGKMGVLRS REKVVDIEINGESVDLHMKLGDNGEAFFVQETDNDQEIIPMYLATSPILS
Lipin_N |
![]() |
---|
PFAM accession number: | PF04571 |
---|---|
Interpro abstract (IPR007651): | Mutations in the lipin gene lead to fatty liver dystrophy in mice. The protein has been shown to be phosphorylated by the TOR Ser/Thr protein kinases in response to insulin stimulation. This entry represents a conserved domain found at the N terminus of the member proteins [ (PUBMED:11138012) (PUBMED:11792863) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Lipin_N