The domain within your query sequence starts at position 426 and ends at position 486; the E-value for the Loricrin domain shown below is 1.4e-14.
GGCGGGSSGGSGGGCGGGYSGGGGGGSSCGGGSSGGGSGGGKGVPVCHQTQQKQAPTWPC K
Loricrin |
![]() |
---|
PFAM accession number: | PF15847 |
---|---|
Interpro abstract (IPR031700): | Loricrin is a major keratinocyte cell envelope protein [ (PUBMED:2007607) ]. The cornified cell envelope is a structure that replaces the plasma membrane during keratinocyte terminal differentiation. Loricrin acts as an important epidermal barrier, comprising 70% of the total protein mass of the cornified layer. Expression of Loricrin is regulated by TNF-alpha via a c-Jun N-terminal kinase-dependent pathway [ (PUBMED:21346775) ]. Loricrin mutations cause the Vohwinkel syndrome [ (PUBMED:12072018) ] and other congenital skin abnormalities collectively termed as loricrin keratoderma [ (PUBMED:12615358) ]. |
GO component: | cornified envelope (GO:0001533) |
GO function: | structural constituent of skin epidermis (GO:0030280) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Loricrin