The domain within your query sequence starts at position 174 and ends at position 467; the E-value for the Lung_7-TM_R domain shown below is 1.4e-97.

TQKDGFHIFIVSIKTEKTDAVWDLNVSLSMVGPHGYISASDWPLMIFYMVMCIVYILYGV
LWLLWSACYWKDILRIQFWIAAVIFLGMLEKAVFYSEYQNINSTGLSTQGLLIFAELISA
VKRTLARLLVIIVSLGYGIVKPRLGTVMHRVIGLGLLYLIFAAIEGVMRVIGGSKHLAVV
LTDIVLAVIDSIFVWFISFTMSFQNSWCLAQTMKTLRLRKNTVKFSLYRHFTNTLIFAVL
ASIVFMVWTTKTFRIAKCQSDWMELWVDDAFWSFLFSVILIVIMFLWRPSANNQ

Lung_7-TM_R

Lung_7-TM_R
PFAM accession number:PF06814
Interpro abstract (IPR009637): This entry represents a group of transmembrane proteins, including mammalian lung seven transmembrane receptor GPR107 and GPR108. GPR107 localizes to the trans-Golgi network and is essential for retrograde transport [(PUBMED:25031321)]. This entry also includes proteins from fungi and plants [(PUBMED:17454009)].
GO component:integral component of membrane (GO:0016021)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Lung_7-TM_R