The domain within your query sequence starts at position 147 and ends at position 368; the E-value for the LuxC domain shown below is 2.4e-7.
SDGDIFTYTRREPIGVCGQIIPWNFPMLMFIWKIGPALSCGNTVVVKPAEQTPLTALHLA SLIKEAGFPPGVVNIVPGYGPTAGAAISSHMDVDKVAFTGSTQVGKLIKEAAGKSNLKRV TLELGGKSPCIVFADADLDIAVEFAHHGVFYHQGQCCVAASRIFVEESVYDEFVKRSVER AKKYVLGNPLTPGINQGPQIDKEQHDKILDLIESGKKEGAKL
LuxC |
---|
PFAM accession number: | PF05893 |
---|---|
Interpro abstract (IPR008670): | This family consists of several bacterial Acyl-CoA reductase (also known as long-chain-fatty-acyl-CoA reductase) LuxC proteins. The channelling of fatty acids into the fatty aldehyde substrate for the bacterial bioluminescence reaction is catalysed by a fatty acid reductase multienzyme complex, which channels fatty acids through the thioesterase (LuxD), synthetase (LuxE) and reductase (LuxC) components [ (PUBMED:9128139) (PUBMED:2030669) ]. |
GO process: | oxidation-reduction process (GO:0055114), bioluminescence (GO:0008218) |
GO function: | acyl-CoA dehydrogenase activity (GO:0003995) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry LuxC