The domain within your query sequence starts at position 11 and ends at position 175; the E-value for the Lyase_1 domain shown below is 4.6e-54.

GRFVGAVDPIMEKFNSSISYDRHLWNVDVQGSKAYSRGLEKAGLLTKAEMQQILQGLDKV
AEEWAQGTFKLHPNDEDIHTANERRLKELIGEAAGKLHTGRSRNDQVVTDLRLWMRQTCS
KLSALLRVLIGTMVDRAEAERDVLFPGYTHLQRAQPIRWSHWILS

Lyase_1

• PFAM accession number: PF00206
• Interpro abstract (IPR022761):

  A number of enzymes, belonging to the lyase class, for which fumarate is a substrate, have been shown to share a short conserved sequence around a methionine which is probably involved in the catalytic activity of this type of enzymes [ (PUBMED:3282546) ]. This entry represents the N-terminal region of fumarate lyase family.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Lyase_1