The domain within your query sequence starts at position 11 and ends at position 305; the E-value for the Lyase_1 domain shown below is 1.8e-107.
GRFVGAVDPIMEKFNSSISYDRHLWNVDVQGSKAYSRGLEKAGLLTKAEMQQILQGLDKV AEEWAQGTFKLHPNDEDIHTANERRLKELIGEAAGKLHTGRSRNDQVVTDLRLWMRQTCS KLSALLRVLIGTMVDRAEAERDVLFPGYTHLQRAQPIRWSHWILSHAVALTRDSERLLEV QKRINVLPLGSGAIAGNPLGVDRELLRAELNFGAITLNSMDATSERDFVAEFLFWASLCM THLSRMAEDLILYGTKEFSFVQLSDAYSTGSSLMPQKKNPDSLELIRSKAGRVFG
Lyase_1 |
---|
PFAM accession number: | PF00206 |
---|---|
Interpro abstract (IPR022761): | A number of enzymes, belonging to the lyase class, for which fumarate is a substrate, have been shown to share a short conserved sequence around a methionine which is probably involved in the catalytic activity of this type of enzymes [ (PUBMED:3282546) ]. This entry represents the N-terminal region of fumarate lyase family. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Lyase_1