The domain within your query sequence starts at position 47 and ends at position 313; the E-value for the Lyase_1 domain shown below is 8.4e-29.

AEAEQTLGLPITDEQIQEMKSNLNNIDFQMAAEEEKRLRHDVMAHVHTFGHCCPKAAGII
HLGATSCYVGDNTDLIILRNAFDLLLPKLARVISRLADFAKDRADLPTLGFTHFQPAQLT
TVGKRCCLWIQDLCMDLQNLKRVRDELRFRGVKGTTGTQASFLQLFEGDHQKVEQLDKMV
TEKAGFKRAFIITGQTYTRKVDIEVLSVLASLGASVHKICTDIRLLANLKEMEEPFEKQQ
IGSSAMPYKRNPMRSERCCSLARHLMA

Lyase_1

Lyase_1
PFAM accession number:PF00206
Interpro abstract (IPR022761):

A number of enzymes, belonging to the lyase class, for which fumarate is a substrate, have been shown to share a short conserved sequence around a methionine which is probably involved in the catalytic activity of this type of enzymes [(PUBMED:3282546)]. This entry represents the N-terminal region of fumarate lyase family.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Lyase_1