The domain within your query sequence starts at position 116 and ends at position 590; the E-value for the Lyase_aromatic domain shown below is 1.3e-199.

LDGDSLSTEDLVNLGKGRYKIKLTSIAEKKVQQSREVIDSIIKERTVVYGITTGFGKFAR
TVIPANKLQELQVNLVRSHSSGVGKPLSPERCRMLLALRINVLAKGYSGISLETLKQVIE
AFNASCLSYVPEKGTVGASGDLAPLSHLALGLIGEGKMWSPKSGWADAKYVLEAHGLKPI
VLKPKEGLALINGTQMITSLGCEALERASAIARQADIVAALTLEVLKGTTKAFDTDIHAV
RPHRGQIEVAFRFRSLLDSDHHPSEIAESHRFCDRVQDAYTLRCCPQVHGVVNDTIAFVK
DIITTELNSATDNPMVFASRGETISGGNFHGEYPAKALDYLAIGVHELAAISERRIERLC
NPSLSELPAFLVAEGGLNSGFMIAHCTAAALVSESKALCHPSSVDSLSTSAATEDHVSMG
GWAARKALRVVEHVEQVLAIELLAACQGIEFLRPLKTTTPLEKVYDLVRSVVRPW

Lyase_aromatic

Lyase_aromatic
PFAM accession number:PF00221
Interpro abstract (IPR001106):

This family includes phenylalanine ammonia-lyase, (PAL; EC 4.3.1.24), histidine ammonia-lyase, (HAL; EC 4.3.1.3), and tyrosine aminomutase, (EC 5.4.3.6) [(PUBMED:7925471), (PUBMED:10220322), (PUBMED:16793524)].

PAL and HAL are members of the Lyase class I_like superfamily of enzymes that, catalyze similar beta-elimination reactions and are active as homotetramers. Both PAL and HAL contain a catalytic Ala-Ser-Gly triad that is post-translationally cyclised [(PUBMED:16478474)]. PAL is a key biosynthetic catalyst in phenylpropanoid assembly in plants and fungi, and is involved in the biosynthesis of a wide variety of secondary metabolites such as flavanoids, furanocoumarin phytoalexins and cell wall components. These compounds are important for normal growth and in responses to environmental stress. HAL catalyses the first step in histidine degradation, the removal of an ammonia group from histidine to produce urocanic acid. The core domain in PAL and HAL share about 30% sequence identity, with PAL containing an additional approximately 160 residues extending from the common fold [(PUBMED:15350127)]. Tyrosine 2,3-aminomutase has aminomutase activity and, to a much lesser extent, ammonia-lyase activity [(PUBMED:19222035)].

PAL is being explored as enzyme substitution therapy for Phenylketonuria (PKU), a disorder which involves an inability to metabolize phenylalanine. HAL failure in humans results in the disease histidinemia [(PUBMED:11578924), (PUBMED:12502351), (PUBMED:12667480), (PUBMED:11895450)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Lyase_aromatic