The domain within your query sequence starts at position 111 and ends at position 354; the E-value for the M-inducer_phosp domain shown below is 2.4e-78.

MDSPSPVDPQMAERTFEQAIQAASRVIQNEQFTIKRFRSLPVRLLEHSPVLQSITNSRAL
DSWRKTEAGYRAAANSPGEDKENVRFQRPRWRSSRERRCLTTEWKMEVEELSPVAQSSSL
TPVERASEEDDGFVDILESDLKDDEKVPAGMENLISAPLVKKLDKEEEQDLIMFSKCQRL
FRSPSMPCSVIRPILKRLERPQDRDVPVQSKRRKSVTPLEEQQLEEPKARVFRSKSLCHE
IENI

M-inducer_phosp

M-inducer_phosp
PFAM accession number:PF06617
Interpro abstract (IPR000751):

M-phase inducer phosphatases function as dosage-dependent inducers in mitotic control [(PUBMED:1836978), (PUBMED:2120044), (PUBMED:8156993), (PUBMED:1392080)]. They are tyrosine protein phosphatases required for progression of the cell cycle. They may directly dephosphorylate p34(cdc2) and activate p34(cdc2) kinase activity. They catalyse the reaction:

protein tyrosine phosphate + H2O = protein tyrosine + Pi
GO process:protein dephosphorylation (GO:0006470), positive regulation of cell cycle G2/M phase transition (GO:1902751)
GO component:intracellular (GO:0005622)
GO function:protein tyrosine phosphatase activity (GO:0004725)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry M-inducer_phosp