The domain within your query sequence starts at position 216 and ends at position 377; the E-value for the M20_dimer domain shown below is 3.4e-17.
YGTRGNCYFTVEVKCRDQDFHSGTFGGILNEPMADLVALLGSLVDSSGHILIPGIYDQMA PITEGEKTMYKNIDMDLEEYQNINQVEKFLFDTKEELLMHLWRYPSLSIHGIEGAFDEPG TKTVIPGRVLGKFSIRLVPTMSPSVVEKQVTQHLEAVFSKRN
M20_dimer |
![]() |
---|
PFAM accession number: | PF07687 |
---|---|
Interpro abstract (IPR011650): | This domain consists of 4 beta strands and two alpha helices which make up the dimerisation surface of members of the MEROPS peptidase family M20 [ (PUBMED:9083113) ]. This family includes a range of zinc exopeptidases: carboxypeptidases, dipeptidases and specialised aminopeptidases [ (PUBMED:7674922) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry M20_dimer