The domain within your query sequence starts at position 188 and ends at position 302; the E-value for the M20_dimer domain shown below is 1.4e-17.

YSERSPWWVQVTSTGKPGHASRFIEDTAAEKLHKVISSILAFREKERQRLQANPHLKEGA
VTSVNLTKLEGGVAYNVVPATMSASFDFRVAPDVDMKAFEKQLQRWCQEAGEGVT

M20_dimer

M20_dimer
PFAM accession number:PF07687
Interpro abstract (IPR011650): This domain consists of 4 beta strands and two alpha helices which make up the dimerisation surface of members of the MEROPS peptidase family M20 [(PUBMED:9083113)]. This family includes a range of zinc exopeptidases: carboxypeptidases, dipeptidases and specialised aminopeptidases [(PUBMED:7674922)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry M20_dimer