The domain within your query sequence starts at position 5 and ends at position 82; the E-value for the MAGE_N domain shown below is 4.9e-8.
HNTQYCNLEESAQAQQESDNDQETMETSEEEEDTTTSNKVYGSAIPSPPQSPQRAYSPCV ALASIPDSPSEEASIKGS
MAGE_N |
![]() |
---|
PFAM accession number: | PF12440 |
---|---|
Interpro abstract (IPR021072): | This domain is found N-terminal in various melanoma associated antigens from eukaryotes, and is typically between 82 and 96 amino acids in length. These are tumour rejection antigens which are expressed on HLA-A1 of tumour cells and they are recognised by cytotoxic T lymphocytes (CTLs) [ (PUBMED:7642112) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry MAGE_N