The domain within your query sequence starts at position 2 and ends at position 43; the E-value for the MAGUK_N_PEST domain shown below is 5.8e-13.

YAKANSPPVIVNTDTLEAPGYELQVNGTEGEMEYEEITLERG

MAGUK_N_PEST

• PFAM accession number: PF10608
• Interpro abstract (IPR019590):

  This domain can be found in Disks large homologue 1 (DLG1 or SAP97), a membrane-associated guanylate kinase protein (MAGUK) that serves as an important determinant of localization and organisation of ion channels into specific plasma membrane domains [ (PUBMED:18245566) ].

  The residues upstream of this domain are the probable palmitoylation sites, particularly two cysteines. The domain has a putative PEST site at the very start that seems to be responsible for poly-ubiquitination [ (PUBMED:8755249) ]. PEST domains are polypeptide sequences enriched in proline (P), glutamic acid (E), serine (S) and threonine (T) that target proteins for rapid destruction. The whole domain, in conjunction with a C-terminal domain of the longer protein, is necessary for dimerisation of the whole protein [ (PUBMED:18215622) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry MAGUK_N_PEST