The domain within your query sequence starts at position 1 and ends at position 124; the E-value for the MAP2_projctn domain shown below is 4.8e-84.
IMDADSLWVDTQDDDRSILTEQLETIPKEERAEKDARRPSLEKHRKEKPFKTGRGRISTP ERKVAKKEPSTVSRDEVRRKKAVYKKAELAKKSEVQAHSPSRKLILKPAIKYTRPTHLSC VKRK
MAP2_projctn |
---|
PFAM accession number: | PF08377 |
---|---|
Interpro abstract (IPR013588): | This domain is found in the microtubule-associated protein 2 (MAP2)/Tau family of proteins which includes MAP2, MAP4, Tau, and their homologues. All isoforms contain a conserved C-terminal domain containing tubulin-binding repeats ( IPR001084 ), and a N-terminal projection domain of varying size. This domain has a net negative charge and exerts a long-range repulsive force. This provides a mechanism that can regulate microtubule spacing which might facilitate efficient organelle transport [ (PUBMED:15642108) (PUBMED:11576531) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry MAP2_projctn