The domain within your query sequence starts at position 510 and ends at position 668; the E-value for the MAP7 domain shown below is 1.4e-61.

APPTAAPSVTPSKPMAGTTDREEATRLLAEKRRQAREQREREEQERKLQAERDKRMREEQ
LAREAEARAEREAEARRREEQEAREKAQAEQEEQERLQKQKEEAEARSREEAERQRQERE
KHFQKEEQERQERRKRLEEIMKRTRKSEAAETKKQDAKE

MAP7

MAP7
PFAM accession number:PF05672
Interpro abstract (IPR008604):

MAP7 (also known as E-MAP-115 or Ensconsin) is a microtubule-stabilising protein that may play an important role in microtubule reorganisation during polarisation and differentiation of epithelial cells [ (PUBMED:11719555) ]. It may play a role in the formation of intercellular contacts [ (PUBMED:11719555) (PUBMED:9989799) ].

The MAP7 family has three other members: MAP7 domain containing proteins 1 (MAP7D1), 2 (MAP7D2) and 3 (MAP7D3) [ (PUBMED:24927501) ]. MAP7D3 has been identified as a critical regulator of microtubule stability, probably through its binding to tubulin and microtubules, as well as its regulation of histone deacetylase 6 activity [ (PUBMED:22142902) (PUBMED:24614595) ].

GO process:microtubule cytoskeleton organization (GO:0000226)
GO component:microtubule cytoskeleton (GO:0015630)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry MAP7