The domain within your query sequence starts at position 17 and ends at position 147; the E-value for the MAPEG domain shown below is 1e-26.
FLLCSTLLVIKMYAVAVITGQMRLRKKAFANPEDALKRGGLQYYRSDPDVERCLRAHRND METIYPFLFLGFVYSFLGPNPLIAWIHFLVVLTGRVVHTVAYLGKLNPRLRSGAYVLAQF SCFSMALQILW
MAPEG |
---|
PFAM accession number: | PF01124 |
---|---|
Interpro abstract (IPR001129): | This entry represents a widespread superfamily known as MAPEG (Membrane Associated Proteins in Eicosanoid and Glutathione metabolism) [ (PUBMED:10091672) ]. Included are:
Because of structural similarities in the active sites of FLAP, LTC4 synthase and PGE synthase, substrates for each enzyme can compete with one another and modulate synthetic activity. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry MAPEG