The domain within your query sequence starts at position 14 and ends at position 128; the E-value for the MAS20 domain shown below is 7.6e-35.
LAAGGAVVLLSYCVYLDWRRHRDPAFRRRLQDKRRAGQPKAQAPARQLWDPVKKEELQEY FFREVQMGKLCLIRGERGMGFEHLTNALLVCEQPKELLMFFKKTLPPEVFQMLLD
MAS20 |
---|
PFAM accession number: | PF02064 |
---|---|
Interpro abstract (IPR002056): | Virtually all mitochondrial precursors are imported via the same mechanism [ (PUBMED:7709435) ]: precursors first bind to receptors on the mitochondrial surface, then insert into the translocation channel in the outer membrane. Many outer-membrane proteins participate in the early stages of import, four of which (MAS20, MAS22, MAS37 and MAS70) are components of the receptor. MAS20, which forms a subcomplex with MAS22, seems to interact with most or all mitochondrial precursors, suggesting that the protein binds directly to mitochondrial targeting sequences. The MAS37 and MAS70 components also form a subcomplex, the two subcomplexes possibly binding via their trans- membrane (TM) regions - the TM region of MAS70 promotes oligomerisation of attatched protein domains and shares sequence similarity with the TM region of MAS20 [ (PUBMED:8163528) ]. MAS20 is also known as TOM20. |
GO process: | protein targeting (GO:0006605), intracellular protein transport (GO:0006886) |
GO component: | mitochondrial outer membrane translocase complex (GO:0005742) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry MAS20