The domain within your query sequence starts at position 78 and ends at position 166; the E-value for the MBD_C domain shown below is 1.2e-22.

AGELLSTSDLAKTLKDLTSTDTVASASDTQATSIDITSVPTLESSSHLANMIPEAGPQIL
CKEFLVTEQDIINQERKVKIARERLAVAL

MBD_C

MBD_C
PFAM accession number:PF14048
Interpro abstract (IPR025884):

CpG-methylation is a frequently occurring epigenetic modification of vertebrate genomes resulting in transcriptional repression. This domain is found at the C terminus of the methyl-CpG-binding domain (MBD) containing proteins MBD2 [(PUBMED:16246164)] and MBD3 [(PUBMED:12124384)]. The latter was shown to not bind directly to methyl-CpG DNA but rather interact with components of the NuRD/Mi2 complex [(PUBMED:17694084)], an abundant deacetylase complex.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry MBD_C