The domain within your query sequence starts at position 161 and ends at position 510; the E-value for the MBOAT domain shown below is 3.9e-71.

FNLLAYAFGKFPTVIWTWWAMFLSTLSIPYFLFQRWAHGYSKSSHPLIYSLVHGLLFLVF
QLGVLGFVPTYVVLAYTLPPASRFILILEQIRLIMKAHSFVRENIPRVLNAAKEKSSKDP
LPTVNQYLYFLFAPTLIYRDNYPRTPTVRWGYVAMQFLQVFGCLFYVYYIFERLCAPLFR
NIKQEPFSARVLVLCVFNSILPGVLILFLSFFAFLHCWLNAFAEMLRFGDRMFYKDWWNS
TSYSNYYRTWNVVVHDWLYYYVYKDLLWFFSKRFKSAAMLAVFALSAVVHEYALAICLSY
FYPVLFVLFMFFGMAFNFIVNDSRKRPIWNIMVWASLFLGYGLILCFYSQ

MBOAT

MBOAT
PFAM accession number:PF03062
Interpro abstract (IPR004299): The MBOAT (membrane bound O-acyl transferase) family of membrane proteins contains a variety of acyltransferase enzymes. A conserved histidine has been suggested to be the active site residue [(PUBMED:10694878)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry MBOAT