The domain within your query sequence starts at position 730 and ends at position 798; the E-value for the MCC-bdg_PDZ domain shown below is 1.3e-27.

KKLKARVQELVSALERLTKSSEIRHQQSAEFVNDLKRANSNLVAAYEKAKKKHQNKLKKL
ESQMMAMVE

MCC-bdg_PDZ

MCC-bdg_PDZ
PFAM accession number:PF10506
Interpro abstract (IPR019536):

The entry represents a protein that has a high homology to the tumour suppressor Usher syndrome type-1C protein-binding protein 1, or known as MCC2 (mutated in colon cancer).

MCC2 protein binds the first PDZ domain of AIE-75 with its C-terminal amino acids -DTFL. A possible role of MCC2 as a tumour suppressor has been put forward. The carboxyl terminus of the predicted protein was DTFL which matched the consensus motif X-S/T-X-phi (phi: hydrophobic amino acid residue) for binding to the PDZ domain of AIE-75 [(PUBMED:11311560), (PUBMED:15219944)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry MCC-bdg_PDZ